Yahoo Malaysia Web Search

Search results

1. Dictionary

   primary

   /ˈprʌɪm(ə)ri/

   adjective

   • 1. of chief importance; principal: "the government's primary aim is to see significant reductions in unemployment" Similar mainchiefkeyprimecentralprincipalforemostfirstmost importantpredominantparamountoverridingmajorrulingdominantmastersupremecardinalpre-eminentultimateinformal:number-oneOpposite secondarysubordinate
   • 2. earliest in time or order: "the primary stage of their political education" Similar originalearliestinitialbeginningfirstessentialfundamentalbasicOpposite secondary
   • ▪ relating to or denoting education for children between the ages of about five and eleven: British "a primary teacher"
   • 3. not derived from, caused by, or based on anything else; original: "his expert handling of the primary and secondary literature is clear on every page"
   • ▪ belonging to or directly derived from the first stage of development or growth: "a primary bone tumour"
   • 4. (of an organic compound) having its functional group located on a carbon atom which is bonded to no more than one other carbon atom: "a primary alcohol"
   • ▪ (chiefly of amines) derived from ammonia by replacement of one hydrogen atom by an organic group.
   • 5. denoting or relating to organisms that produce organic compounds from simple substances such as water and carbon dioxide, typically by photosynthesis: "the organic matter is formed by primary producers such as plants and plankton"
   • ▪ denoting or relating to consumer organisms at the lowest level in a community's food chain, which eat autotrophic organisms: "seed-eating birds and herbivorous insects are primary consumers"
   • 6. relating to or denoting the input side of a transformer or other inductive device.
   • 7. former term for Palaeozoic

   noun

   • 1. (in the US) a preliminary election to appoint delegates to a party conference or to select the candidates for a principal, especially presidential, election: "these two Republicans should win their primaries easily"
   • 2. a primary colour.
   • ▪ a primary feather.
   • ▪ the body orbited by a smaller satellite or companion.
   • ▪ a primary coil or winding in an electrical transformer.
   • 3. the Palaeozoic era. dated

   verb

   • 1. (in the US) run against (the current holder of a political office) in the preliminary election a party uses to select its candidate for the main election: "I'm not primarying the president, and no one else should either unless we want to lose the White House"

   Word Origin late Middle English (in the sense ‘original, not derivative’): from Latin primarius, from primus ‘first’. The noun uses date from the 18th century.

   Scrabble Points: 14

   • P

     3

   • R

     1

   • I

     1

   • M

     3

   • A

     1

   • R

     1

   • Y

     4

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.merriam-webster.com › dictionary › primaryPrimary Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › primary

   • Cached

   1. : first in order of time or development : primitive. the primary stage of civilization. the primary lesion of a disease. 2. a. : of first rank, importance, or value : principal. the primary purpose. b. : basic, fundamental. security is a primary need. c. : of, relating to, or constituting the principal flight feathers of a bird's wing. d.

3. dictionary.cambridge.org › dictionary › englishPRIMARY | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   PRIMARY definition: 1. more important than anything else; main: 2. of or for the teaching of young children…. Learn more.

4. www.collinsdictionary.com › dictionary › englishPRIMARY definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   A primary or a primary election is an election in an American state in which people vote for someone to become a candidate for a political office. Compare general election. ...the 1968 New Hampshire primary. She won the Democratic primary. New York holds its primary election on Tuesday. More Synonyms of primary.

5. www.vocabulary.com › dictionary › primaryPrimary - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › primary

   Definitions of primary. adjective. of first rank or importance or value; direct and immediate rather than secondary. “ primary goals” “a primary effect” “ primary sources” “a primary interest” synonyms: essential. basic and fundamental. first. preceding all others in time or space or degree. original.

6. www.thefreedictionary.com › primaryPrimary - definition of primary by The Free Dictionary

   www.thefreedictionary.com › primary

   • Cached

   adj. 1. First or highest in rank or importance; principal. See Synonyms at chief. 2. a. Occurring first in time or sequence; earliest: the primary stages of the project. b. Of or relating to primary schools. 3. a.

7. www.definitions.net › definition › primaryWhat does primary mean? - Definitions.net

   www.definitions.net › definition › primary

   • Cached

   A base or fundamental component; something that is irreducible. primary noun. The most massive component of a gravitationally bound system.

8. www.thesaurus.com › browse › primary35 Synonyms & Antonyms for PRIMARY | Thesaurus.com

   www.thesaurus.com › browse › primary

   • Cached

   Dec 20, 1991 · prime. principal. underlying. vital. Strong matches. central. chief. first. primitive. simple. Weak matches. direct. earliest. idiopathic. primal. Discover More. Example Sentences. The primary piece of Clubhouse’s user recommendation engine relies on access to your contacts. From Vox.

9. www.scribbr.com › working-with-sources › primary-and-secondary-sourcesPrimary vs. Secondary Sources | Difference & Examples - Scribbr

   www.scribbr.com › working-with-sources › primary-and-secondary-sources

   • Cached

   Jun 20, 2018 · A primary source is anything that gives you direct evidence about the people, events, or phenomena that you are researching. Primary sources will usually be the main objects of your analysis.

10. www.who.int › health-topics › primary-health-carePrimary health care - World Health Organization (WHO)

    www.who.int › health-topics › primary-health-care

    • Cached

    Jun 7, 2024 · Primary health care is a whole-of-society approach to effectively organize and strengthen national health systems to bring services for health and wellbeing closer to communities. It has 3 components: integrated health services to meet people’s health needs throughout their lives.

11. keydifferences.com › difference-between-primary-and-secondary-dataDifference Between Primary and Secondary Data

    keydifferences.com › difference-between-primary-and-secondary-data

    • Cached

    As the name suggests, primary data is one which is collected for the first time by the researcher while secondary data is the data already collected or produced by others. There are many differences between primary and secondary data, which are discussed in this article.