Yahoo Malaysia Web Search

Search results

1. Dictionary

   coat

   /kəʊt/

   noun

   • 1. an outer garment with sleeves, worn outdoors and typically extending below the hips: "a winter coat" Similar overcoattunic
   • ▪ a protective outer garment worn indoors: "a laboratory coat"
   • ▪ a man's jacket, especially as worn when hunting or by soldiers.
   • ▪ a woman's tailored jacket, worn with a skirt or dress: "she wore a pale linen coat and skirt"
   • 2. an animal's covering of fur or hair: "a dog's coat may become tangled and matted" Similar furhairwoolfleecehidepeltskinarchaic:fell
   • 3. an outer layer or covering: "the protein coat of the virus" Similar layercoveringoverlaycoatingskinskimplatingfilmwashglazevarnishveneerlaminationsheetfinishdustingblanketmantledaubsmeartoppingcrustpatinalustredepositscalefacingcladding
   • ▪ a single application of paint or similar material on a surface: "apply a final top coat of varnish"
   • ▪ a structure, especially a membrane, enclosing or lining an organ.
   • ▪ the skin or husk of a fruit or seed.
   • ▪ a layer of a plant bulb.

   verb

   • 1. provide with a layer or covering of something: "her right leg was coated in plaster"
   • ▪ (of a substance) form a covering to: "a film of dust coated the floor"

   Word Origin Middle English: from Old French cote, of unknown ultimate origin.

   Derivatives

   • 1. coated adjective

   Scrabble Points: 6

   • C

     3

   • O

     1

   • A

     1

   • T

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points