Yahoo Malaysia Web Search

Search results

1. Dictionary

   coat

   /kəʊt/

   noun

   • 1. an outer garment with sleeves, worn outdoors and typically extending below the hips: "a winter coat" Similar overcoattunic
   • ▪ a protective outer garment worn indoors: "a laboratory coat"
   • ▪ a man's jacket, especially as worn when hunting or by soldiers.
   • ▪ a woman's tailored jacket, worn with a skirt or dress: "she wore a pale linen coat and skirt"
   • 2. an animal's covering of fur or hair: "a dog's coat may become tangled and matted" Similar furhairwoolfleecehidepeltskinarchaic:fell
   • 3. an outer layer or covering: "the protein coat of the virus" Similar layercoveringoverlaycoatingskinskimplatingfilmwashglazevarnishveneerlaminationsheetfinishdustingblanketmantledaubsmeartoppingcrustpatinalustredepositscalefacingcladding
   • ▪ a single application of paint or similar material on a surface: "apply a final top coat of varnish"
   • ▪ a structure, especially a membrane, enclosing or lining an organ.
   • ▪ the skin or husk of a fruit or seed.
   • ▪ a layer of a plant bulb.

   verb

   • 1. provide with a layer or covering of something: "her right leg was coated in plaster"
   • ▪ (of a substance) form a covering to: "a film of dust coated the floor"

   Word Origin Middle English: from Old French cote, of unknown ultimate origin.

   Derivatives

   • 1. coated adjective

   Scrabble Points: 6

   • C

     3

   • O

     1

   • A

     1

   • T

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. dictionary.cambridge.org › dictionary › englishCOAT | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   a layer of a substance, especially paint, that covers something: give something a coat of something I'll give the walls a quick coat of paint. two coats of varnish. SMART Vocabulary: related words and phrases. coat. verb [ T ] uk / kəʊt / us / koʊt / to cover something with a layer of a particular substance:

3. www.merriam-webster.com › dictionary › coatCoat Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › coat

   • Cached

   The meaning of COAT is an outer garment worn on the upper body and varying in length and style according to fashion and use. How to use coat in a sentence.

4. www.oxfordlearnersdictionaries.com › definition › englishcoat noun - Definition, pictures, pronunciation and usage notes...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   noun. /kəʊt/ Idioms. a piece of outdoor clothing that is worn over other clothes to keep warm or dry. Coats have sleeves (= parts covering the arms) and may be long or short. to wear a coat. to put on/take off your coat. a fur coat. a leather coat. a long winter coat. in a coat a man in a black coat. I dressed in my finest blue wool coat.

5. www.thefreedictionary.com › coatCoat - definition of coat by The Free Dictionary

   www.thefreedictionary.com › coat

   • Cached

   1. (Clothing & Fashion) an outdoor garment with sleeves, covering the body from the shoulder to waist, knee, or foot. 2. (Clothing & Fashion) any similar garment, esp one forming the top to a suit. 3. a layer that covers or conceals a surface: a coat of dust.

6. www.vocabulary.com › dictionary › coatCoat - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › coat

   noun. a thin layer covering something. “a second coat of paint”. synonyms: coating. see more. a protective coating of asphalt and filter used on structural metals that are exposed to weathering. a light-sensitive coating on paper or film; consists of fine grains of silver bromide suspended in a gelatin.

7. www.dictionary.com › browse › coatCOAT Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › coat

   • Cached

   Coat definition: an outer garment with sleeves, covering at least the upper part of the body. See examples of COAT used in a sentence.

8. dictionary.cambridge.org › dictionary › learner-englishMeaning of coat – Learner’s Dictionary - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › learner-english

   • Cached

   a layer of a substance such as paint: a coat of paint / varnish. coat. verb [ T ] uk / kəʊt / us. to cover something with a thin layer of something: Stir the rice until it is coated with butter.